PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013603850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 250aa    MW: 28347 Da    PI: 8.4725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013603850.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.3e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++lv ++ ++G g+W+ ++++ g+ R++k+c++r ++yl
   XP_013603850.1 14 RGKWSEEEDQKLVAYIDEYGIGDWRFVPHRTGLLRCGKSCRLRRLNYL 61
                     89******************************99*********99997 PP

2Myb_DNA-binding45.81.4e-1467111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+ E++ +v+ +  +G++ W+ Ia++m+ gR+++++k++w++ 
   XP_013603850.1  67 KGKLTPREEQDIVNFHSVFGNR-WAVIAQYMP-GRSDNNIKNHWNSC 111
                      6889******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.274961IPR017930Myb domain
SuperFamilySSF466892.31E-2612108IPR009057Homeodomain-like
SMARTSM007171.3E-101363IPR001005SANT/Myb domain
PfamPF002492.6E-121461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-181568IPR009057Homeodomain-like
CDDcd001676.61E-81661No hitNo description
PROSITE profilePS5129422.30462116IPR017930Myb domain
SMARTSM007171.0E-1166114IPR001005SANT/Myb domain
PfamPF002493.6E-1367111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2169117IPR009057Homeodomain-like
CDDcd001671.04E-771109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGGATWFEAD GTKRGKWSEE EDQKLVAYID EYGIGDWRFV PHRTGLLRCG KSCRLRRLNY  60
LRPEVKKGKL TPREEQDIVN FHSVFGNRWA VIAQYMPGRS DNNIKNHWNS CLKKRLKRNG  120
IDPMTHQPII NLAVKTPSFN TDCGSSSSLT ASPSSSSSSL SGSARLLNKI ATSISSRQQG  180
VERIKDIMSD PRITCINGQA KELEESKKDH GKILASSDDQ EDDFLMWDEE KVRRFMEEIG  240
VMDLETNGVY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603850.10.0PREDICTED: transcription factor MYB122-like
TrEMBLA0A0D3DTQ50.0A0A0D3DTQ5_BRAOL; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_10016921e-121(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.14e-78myb domain protein 47